PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_34539.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 841aa    MW: 93335 Da    PI: 8.484
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_34539.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.33.2e-36110186278
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   C v+gC+adl + ++yhrrhkvCevh+k++ v ++++e+rfCqqCsrfh ++efDe+k+sCr+rL+khn rrrk+qa
  MLOC_34539.4 110 CLVDGCHADLRDGRDYHRRHKVCEVHTKSTLVRIKNIEHRFCQQCSRFHLVQEFDEGKKSCRSRLEKHNGRRRKAQA 186
                   **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-29102171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.855107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.5E-34108188IPR004333Transcription factor, SBP-box
PfamPF031103.5E-27110183IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.84E-6581728IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.208.8E-5582729IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MSSGLKNKKK KGHEWDLNDW RWDGNLFLAA PSSNAEAPSG CGSRELGRAE EGGSFGAADK  60
SRRRRRRVST VDNPEEPPHE RIAVRRGQIS EEERPANATA GASSSSAPSC LVDGCHADLR  120
DGRDYHRRHK VCEVHTKSTL VRIKNIEHRF CQQCSRFHLV QEFDEGKKSC RSRLEKHNGR  180
RRKAQAQAVS SSSENQSLTN TLLLLLRQLA GQDSAASSSE QINGPNFLVN LLKNLAAVAG  240
TQACQDMLKD ATSSNAGNYV GNQSGPPVPA EEPPMKRRAR NFDLNDTYVE EDESRTDKIV  300
FKLFGKQPND FPADLRTQVL NWLSHYPSDM ESYIRPGCVI LTIYLRLPNW MWHKLNVDPA  360
PWIENLISIS THGFWETGWL YARVQDRLTL SCNGRLTLVC PWLPVIGDKH QILCVTPIAA  420
SCKSTANFSV RGFNIAQPTT KLLCIFGGKY LVQEATQKLQ DDTAVQQGPQ CLAFSCSFPS  480
TSGRGFIEVE DYDQSSISFP FVVAEESICC EIRMLEEKLN IFAFANVLEG REDLMASRSQ  540
ALKFLHEIGW LLQRSHSRAT SSKAPQQHRV VGFLAARFRW LLSFAVDQEW CGVVKMLLDT  600
LFQGNIDVPS PVEFVLGESL VFKAVNKRSK PLVDCLLRYT TNSAPVGGGA VATPARFVFT  660
PDMTGPSDIT PLHSAATISN AAAVLDALTD DPQQLGIKAW KNARDATGYT PEDYARRRGH  720
TSYIQMVQNK INRGLPAAHV SVSMTTTGIT EEHADAGRPK STDQTIFDVE KSLPGCRQCV  780
QLQHIAYRPC PNRFLSNRPA VLSLVAIATV CVCVGLIMQS PPVVRGMPGP FLWNRLRWGP  840
T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-25101183184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16166RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2520860.0AK252086.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf140n19, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230803.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X2
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLM0VMT70.0M0VMT7_HORVD; Uncharacterized protein
STRINGMLOC_34539.40.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.11e-132squamosa promoter-binding protein-like 12